Lineage for d1znca_ (1znc A:)
- Root: SCOPe 2.01
Class b: All beta proteins [48724] (174 folds) 
Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
single sheet; 10 strandsSuperfamily b.74.1: Carbonic anhydrase [51069] (2 families) 
Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins) Protein Carbonic anhydrase [51071] (10 species) 
Species Human (Homo sapiens), isozyme IV [TaxId:9606] [51076] (4 PDB entries) 
Domain d1znca_: 1znc A: [27955]
complexed with so4, zn
Details for d1znca_
PDB Entry: 1znc (more details), 2.8 Å
PDB Description: human carbonic anhydrase iv
PDB Compounds: (A:) carbonic anhydrase IVSCOPe Domain Sequences for d1znca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1znca_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), isozyme IV [TaxId: 9606]}
wcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkkqtwt
vqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfamemhiv
hekekgtsrnvkeaqdpedeiavlaflveagtqvnegfqplvealsnipkpemsttmaes
slldllpkeeklrhyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyydkeq
tvsmkdnvrplqqlgqrtviks
SCOPe Domain Coordinates for d1znca_:
Click to download the PDB-style file with coordinates for d1znca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1znca_:
- d1znca_ first appeared (with stable ids) in SCOP 1.55
- d1znca_ appears in SCOP 1.75
- d1znca_ appears in SCOPe 2.02
- d1znca_ appears in the current release, SCOPe 2.08
View in 3D
