Lineage for d1zmua_ (1zmu A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2199100Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2199101Protein automated matches [190417] (25 species)
    not a true protein
  7. 2200232Species Norway rat (Rattus norvegicus) [TaxId:10116] [267767] (6 PDB entries)
  8. 2200245Domain d1zmua_: 1zmu A: [264235]
    automated match to d4ic8a_

Details for d1zmua_

PDB Entry: 1zmu (more details), 2.9 Å

PDB Description: Catalytic and ubiqutin-associated domains of MARK2/PAR-1: Wild type
PDB Compounds: (A:) MAP/Microtubule affinity regulating kinase 2

SCOPe Domain Sequences for d1zmua_:

Sequence, based on SEQRES records: (download)

>d1zmua_ d.144.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gnyrllktigkgnfakvklarhiltgkevavkiidktqlnssslqklfrevrimkvlnhp
nivklfevietektlylvmeyasggevfdylvahgrmkekearakfrqivsavqychqkf
ivhrdlkaenllldadmnikiadfgfsneftfgnkldtfcgsppyaapelfqgkkydgpe
vdvwslgvilytlvsgslpfdgqnlkelrervlrgkyripfymstdcenllkkflilnps
krgtleqimkdrwmnvgheddelkpyveplpdykdprrtelmvsmgytreeiqdslvgqr
ynevmatylllgy

Sequence, based on observed residues (ATOM records): (download)

>d1zmua_ d.144.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gnyrllktigkgakvklarhiltgkevavkiidktqlnssslqklfrevrimkvlnhpni
vklfevietektlylvmeyasggevfdylvahgrmkekearakfrqivsavqychqkfiv
hrdlkaenllldadmnikiagsppyaapelfqgkkydgpevdvwslgvilytlvsgslpf
dgqnlkelrervlrgkyripfymstdcenllkkflilnpskrgtleqimkdrwmnvghed
delkpyveplpdykdprrtelmvsmgytreeiqdslvgqrynevmatylllgy

SCOPe Domain Coordinates for d1zmua_:

Click to download the PDB-style file with coordinates for d1zmua_.
(The format of our PDB-style files is described here.)

Timeline for d1zmua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1zmub_