Lineage for d1zh2b_ (1zh2 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2114716Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2115095Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2115096Protein automated matches [190131] (71 species)
    not a true protein
  7. 2115216Species Escherichia coli [TaxId:562] [186855] (6 PDB entries)
  8. 2115220Domain d1zh2b_: 1zh2 B: [125070]
    Other proteins in same PDB: d1zh2a1
    automated match to d1mvoa_
    complexed with ca

Details for d1zh2b_

PDB Entry: 1zh2 (more details), 2 Å

PDB Description: crystal structure of the calcium-bound receiver domain of kdp potassium transport system response regulator kdpe
PDB Compounds: (B:) KDP operon transcriptional regulatory protein kdpE

SCOPe Domain Sequences for d1zh2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zh2b_ c.23.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
mtnvlivedeqairrflrtalegdgmrvfeaetlqrglleaatrkpdliildlglpdgdg
iefirdlrqwsavpvivlsarseesdkiaaldagaddylskpfgigelqarlrvalrrhs

SCOPe Domain Coordinates for d1zh2b_:

Click to download the PDB-style file with coordinates for d1zh2b_.
(The format of our PDB-style files is described here.)

Timeline for d1zh2b_: