Lineage for d1z7ub_ (1z7u B:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and downSuperfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) 
contains a small beta-sheet (wing)
Family a.4.5.69: HxlR-like [140304] (6 proteins)
Pfam PF01638; DUF24; the N- and C-terminal helical extensions to the common fold form the dimer interface similar to that of the ArsR-like family (46801)
Protein automated matches [190851] (1 species)
not a true proteinSpecies Enterococcus faecalis [TaxId:226185] [188172] (1 PDB entry) 
Domain d1z7ub_: 1z7u B: [124673]
Other proteins in same PDB: d1z7ua1
automated match to d1z7ua1
complexed with fmt
Details for d1z7ub_
PDB Entry: 1z7u (more details), 2.2 Å
PDB Description: Crystal Structure of the Putitive Transcriptional Regulator of MarR Family from Enterococcus faecalis V583
PDB Compounds: (B:) hypothetical protein EF0647SCOPe Domain Sequences for d1z7ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z7ub_ a.4.5.69 (B:) automated matches {Enterococcus faecalis [TaxId: 226185]}
snamttdkqtsinlalstingkwklslmdelfqgtkrngelmraldgitqrvltdrlrem
ekdglvhresfnelpprveytltpegyalydalsslchwgetfaqkkarl
SCOPe Domain Coordinates for d1z7ub_:
Click to download the PDB-style file with coordinates for d1z7ub_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1z7ub_:
- d1z7ub_ first appeared in SCOP 1.73, called d1z7ub1
- d1z7ub_ appears in SCOPe 2.04
- d1z7ub_ is called d1z7ub2 in SCOPe 2.06
- d1z7ub_ appears in the current release, SCOPe 2.08, called d1z7ub2
View in 3D
