Lineage for d1z3ea1 (1z3e A:1-114)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (24 families) 
Family c.47.1.12: ArsC-like [69518] (4 proteins)
Pfam PF03960
Protein Regulatory protein Spx [142393] (1 species) Species Bacillus subtilis [TaxId:1423] [142394] (1 PDB entry)
Uniprot O31602 1-114
Domain d1z3ea1: 1z3e A:1-114 [124400]
Other proteins in same PDB: d1z3ea2, d1z3eb1
protein/RNA complex; complexed with so4
Details for d1z3ea1
PDB Entry: 1z3e (more details), 1.5 Å
PDB Description: crystal structure of spx in complex with the c-terminal domain of the rna polymerase alpha subunit
PDB Compounds: (A:) Regulatory protein spxSCOPe Domain Sequences for d1z3ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]}
mvtlytspsctscrkarawleeheipfvernifseplsideikqilrmtedgtdeiistr
skvfqklnvnvesmplqdlyrlinehpgllrrpiiidekrlqvgynedeirrfl
SCOPe Domain Coordinates for d1z3ea1:
Click to download the PDB-style file with coordinates for d1z3ea1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1z3ea1:
- d1z3ea1 first appeared in SCOP 1.73
- d1z3ea1 appears in SCOPe 2.06
- d1z3ea1 appears in the current release, SCOPe 2.08
View in 3D
