Lineage for d1z1wa3 (1z1w A:415-489)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1771626Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 1771627Family b.1.30.1: Zn aminopeptidase insert domain [254169] (3 proteins)
  6. 1771641Protein Tricorn protease interacting factor F3 insert domain [254383] (1 species)
  7. 1771642Species Thermoplasma acidophilum [TaxId:2303] [254816] (2 PDB entries)
  8. 1771645Domain d1z1wa3: 1z1w A:415-489 [241104]
    Other proteins in same PDB: d1z1wa1, d1z1wa2, d1z1wa4
    complexed with so4, zn

Details for d1z1wa3

PDB Entry: 1z1w (more details), 2.7 Å

PDB Description: Crystal structures of the tricorn interacting facor F3 from Thermoplasma acidophilum, a zinc aminopeptidase in three different conformations
PDB Compounds: (A:) Tricorn protease interacting factor F3

SCOPe Domain Sequences for d1z1wa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z1wa3 b.1.30.1 (A:415-489) Tricorn protease interacting factor F3 insert domain {Thermoplasma acidophilum [TaxId: 2303]}
gypviklkrngrkitmyqtrfllngeeegrwpvpvnikkkdgverilledeasieadgli
kinadsagfyrvlyd

SCOPe Domain Coordinates for d1z1wa3:

Click to download the PDB-style file with coordinates for d1z1wa3.
(The format of our PDB-style files is described here.)

Timeline for d1z1wa3: