Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) same topology as (b.1.15.1) |
Family b.1.30.1: Zn aminopeptidase insert domain [254169] (3 proteins) |
Protein Tricorn protease interacting factor F3 insert domain [254383] (1 species) |
Species Thermoplasma acidophilum [TaxId:2303] [254816] (2 PDB entries) |
Domain d1z1wa3: 1z1w A:415-489 [241104] Other proteins in same PDB: d1z1wa1, d1z1wa2, d1z1wa4 complexed with so4, zn |
PDB Entry: 1z1w (more details), 2.7 Å
SCOPe Domain Sequences for d1z1wa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z1wa3 b.1.30.1 (A:415-489) Tricorn protease interacting factor F3 insert domain {Thermoplasma acidophilum [TaxId: 2303]} gypviklkrngrkitmyqtrfllngeeegrwpvpvnikkkdgverilledeasieadgli kinadsagfyrvlyd
Timeline for d1z1wa3: