Class b: All beta proteins [48724] (176 folds) |
Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily) duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain |
Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) |
Family b.98.1.1: Zn aminopeptidase N-terminal domain [63738] (4 proteins) |
Protein Tricorn protease interacting factor F3 N-terminal domain [254379] (1 species) |
Species Thermoplasma acidophilum [TaxId:2303] [254812] (2 PDB entries) |
Domain d1z1wa1: 1z1w A:1-170 [241102] Other proteins in same PDB: d1z1wa2, d1z1wa3, d1z1wa4 complexed with so4, zn |
PDB Entry: 1z1w (more details), 2.7 Å
SCOPe Domain Sequences for d1z1wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z1wa1 b.98.1.1 (A:1-170) Tricorn protease interacting factor F3 N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} mevekydltldfdiqkrtfngtetitadagdivldavglqinwmkvngrdtaftydgqtv rapgdsqpqkieisfagkvsdslsgiyyagrengmitthfeatdarrmfpcvdhpaykav faitvvidkdydaisnmppkrievserkvvefqdtprmstyllyvgigkf
Timeline for d1z1wa1: