Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.21: AMPK-beta glycogen binding domain-like [158886] (4 proteins) lacks the N-terminal strand (A) and contains a beta-hairpin insertion in the C-terminal strand (G) |
Protein 5'-AMP-activated protein kinase subunit beta-1 [158891] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [158892] (2 PDB entries) Uniprot P80386 76-162 |
Domain d1z0ma1: 1z0m A:77-163 [145952] Other proteins in same PDB: d1z0mb_, d1z0mc_ complexed with bcd |
PDB Entry: 1z0m (more details), 1.91 Å
SCOPe Domain Sequences for d1z0ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z0ma1 b.1.18.21 (A:77-163) 5'-AMP-activated protein kinase subunit beta-1 {Norway rat (Rattus norvegicus) [TaxId: 10116]} arptvfrwtgggkevylsgsfnnwsklpltrsqnnfvaildlpegehqykffvdgqwthd psepivtsqlgtvnniiqvkktdfevf
Timeline for d1z0ma1: