Lineage for d1yypa2 (1yyp A:136-271)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977007Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2977186Protein UL44 [111176] (2 species)
  7. 2977194Species Human cytomegalovirus, HHV-5 [TaxId:10359] [111177] (2 PDB entries)
    Uniprot P16790 1-290
  8. 2977198Domain d1yypa2: 1yyp A:136-271 [124249]
    automated match to d1t6la2
    complexed with edo, so4

Details for d1yypa2

PDB Entry: 1yyp (more details), 2.5 Å

PDB Description: crystal structure of cytomegalovirus ul44 bound to c-terminal peptide from cmv ul54
PDB Compounds: (A:) DNA polymerase processivity factor

SCOPe Domain Sequences for d1yypa2:

Sequence, based on SEQRES records: (download)

>d1yypa2 d.131.1.2 (A:136-271) UL44 {Human cytomegalovirus, HHV-5 [TaxId: 10359]}
vresensavhvdldfgvvadllkwigphtrvkrnvkkapcptgtvqilvhagppaikfil
tngseleftsnnrvsfhgvknmrinvqlknfyqtllncavtklpctlrivtehdtllyva
srnglfavenflteep

Sequence, based on observed residues (ATOM records): (download)

>d1yypa2 d.131.1.2 (A:136-271) UL44 {Human cytomegalovirus, HHV-5 [TaxId: 10359]}
vresensavhvdldfgvvadllkwigptgtvqilvhagppaikfiltngseleftsnnrv
sfhgvknmrinvqlknfyqtllncavtklpctlrivtehdtllyvasrnglfavenflte
ep

SCOPe Domain Coordinates for d1yypa2:

Click to download the PDB-style file with coordinates for d1yypa2.
(The format of our PDB-style files is described here.)

Timeline for d1yypa2: