Lineage for d1yuta1 (1yut A:1-98)
- Root: SCOPe 2.03
Class a: All alpha proteins [46456] (284 folds) 
Fold a.39: EF Hand-like [47472] (4 superfamilies)
core: 4 helices; array of 2 hairpins, openedSuperfamily a.39.1: EF-hand [47473] (12 families) 
Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
Family a.39.1.2: S100 proteins [47478] (2 proteins)
dimer: subunits are made of two EF-handsProtein Calcyclin (S100) [47479] (17 species) 
Species Human (Homo sapiens), s100a13 [TaxId:9606] [140535] (5 PDB entries)
Uniprot Q99584 1-98
Domain d1yuta1: 1yut A:1-98 [124066]
automatically matched to 1YUR A:1-98
complexed with ca
Details for d1yuta1
PDB Entry: 1yut (more details)
PDB Description: solution structure of calcium-s100a13 (minimized mean structure)
PDB Compounds: (A:) S100 calcium-binding protein A13SCOPe Domain Sequences for d1yuta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]}
maaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekm
ksldvnqdselkfneywrligelakeirkkkdlkirkk
SCOPe Domain Coordinates for d1yuta1:
Click to download the PDB-style file with coordinates for d1yuta1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1yuta1:
- d1yuta1 first appeared in SCOP 1.73
- d1yuta1 appears in SCOPe 2.02
- d1yuta1 is called d1yuta_ in SCOPe 2.04
- d1yuta1 appears in the current release, SCOPe 2.08, called d1yuta_
View in 3D
