Lineage for d1yu2a2 (1yu2 A:171-380)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.169: C-type lectin-like [56435] (1 superfamily)
unusual foldSuperfamily d.169.1: C-type lectin-like [56436] (9 families) 
Family d.169.1.8: Mtd variable domain [143964] (1 protein)
fold decorated with many additional structures; overall similarity to the Sulfatase modifying factor family; lacks the characteristic disulfideProtein Major tropism determinant (Mtd), C-terminal domain [143965] (1 species) Species Bordetella phage bpp-1 [TaxId:194699] [143966] (6 PDB entries)
Uniprot Q775D6 171-380
includes related Bordetella phage proteins
Domain d1yu2a2: 1yu2 A:171-380 [124030]
Other proteins in same PDB: d1yu2a1
complexed with mg
Details for d1yu2a2
PDB Entry: 1yu2 (more details), 1.86 Å
PDB Description: Major Tropism Determinant M1 Variant
PDB Compounds: (A:) Major Tropism Determinant (Mtd-M1)SCOPe Domain Sequences for d1yu2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yu2a2 d.169.1.8 (A:171-380) Major tropism determinant (Mtd), C-terminal domain {Bordetella phage bpp-1 [TaxId: 194699]}
kfrpaaldprgmtlvagafwadiyllgvnhltdgtskynvtiadgsaspkkstkfggdgs
aaysdgawynfaevmthhgkrlpnynefqalafgtteatssggtdvpttgvngtgatsaw
niftskwgvvqasgclwtwgnefggvngaseytantggrgsvyaqpaaalfggswhytsn
sgsraaywysgpsnspanigargvcdhlil
SCOPe Domain Coordinates for d1yu2a2:
Click to download the PDB-style file with coordinates for d1yu2a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1yu2a2:
- d1yu2a2 first appeared in SCOP 1.73
- d1yu2a2 appears in SCOPe 2.04
- d1yu2a2 appears in SCOPe 2.06
- d1yu2a2 appears in the current release, SCOPe 2.08
View in 3D
