Lineage for d1ytma2 (1ytm A:221-518)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912052Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 2912053Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) (S)
  5. 2912198Family c.91.1.0: automated matches [196141] (1 protein)
    not a true family
  6. 2912199Protein automated matches [196142] (6 species)
    not a true protein
  7. 2912200Species Anaerobiospirillum succiniciproducens [TaxId:13335] [230436] (2 PDB entries)
  8. 2912201Domain d1ytma2: 1ytm A:221-518 [230437]
    Other proteins in same PDB: d1ytma1, d1ytmb1
    automated match to d1ayla1
    complexed with atp, mg, mn, oxd

Details for d1ytma2

PDB Entry: 1ytm (more details), 2.2 Å

PDB Description: crystal structure of phosphoenolpyruvate carboxykinase of anaerobiospirillum succiniciproducens complexed with atp, oxalate, magnesium and manganese ions
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase [ATP]

SCOPe Domain Sequences for d1ytma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ytma2 c.91.1.0 (A:221-518) automated matches {Anaerobiospirillum succiniciproducens [TaxId: 13335]}
iaamhcsantdlegkntaiffglsgtgkttlstdpkrlligddehgwdddgvfnfeggcy
akvinlskenepdiwgaikrnallenvtvdangkvdfadksvtentrvsypifhiknivk
pvskapaakrviflsadafgvlppvsilskeqtkyyflsgftaklagtergiteptptfs
scfgaafltlpptkyaevlvkrmeasgakaylvntgwngtgkrisikdtrgiidaildgs
idtantatipyfnftvptelkgvdtkildprntyadasewevkakdlaerfqknfkkf

SCOPe Domain Coordinates for d1ytma2:

Click to download the PDB-style file with coordinates for d1ytma2.
(The format of our PDB-style files is described here.)

Timeline for d1ytma2:

2912201
d1ytma2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1ytma1