Class b: All beta proteins [48724] (176 folds) |
Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) two constituent families are related by circular permutation |
Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins) |
Protein automated matches [190564] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188151] (1 PDB entry) |
Domain d1yrka_: 1yrk A: [162285] automated match to d1bdya_ complexed with acy |
PDB Entry: 1yrk (more details), 1.7 Å
SCOPe Domain Sequences for d1yrka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yrka_ b.7.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gshmapflriafnsyelgslqaedeanqpfcavkmkealstergktlvqkkptmypewks tfdahiyegrviqivlmraaeepvsevtvgvsvlaerckknngkaefwldlqpqakvlms vqyfle
Timeline for d1yrka_: