Lineage for d1yq3b1 (1yq3 B:6-114)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) 
Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) 
Protein Succinate dehydogenase iron-sulfur protein, N-terminal domain [82586] (3 species) Species Chicken (Gallus gallus) [TaxId:9031] [254759] (6 PDB entries) 
Domain d1yq3b1: 1yq3 B:6-114 [230425]
Other proteins in same PDB: d1yq3b2, d1yq3c_, d1yq3d_
automated match to d2bs2b2
complexed with bhg, f3s, fad, fes, gol, hem, pee, sf4, teo, unl, uq
Details for d1yq3b1
PDB Entry: 1yq3 (more details), 2.2 Å
PDB Description: avian respiratory complex ii with oxaloacetate and ubiquinone
PDB Compounds: (B:) succinate dehydrogenase Ip subunitSCOPe Domain Sequences for d1yq3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yq3b1 d.15.4.2 (B:6-114) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
aatsrikkfsiyrwdpdkpgdkprmqtyevdlnkcgpmvldalikikneldstltfrrsc
regicgscamniaggntlactkkidpdlskttkiyplphmyvvkdlvpd
SCOPe Domain Coordinates for d1yq3b1:
Click to download the PDB-style file with coordinates for d1yq3b1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1yq3b1:
- d1yq3b1 first appeared in SCOPe 2.03
- d1yq3b1 appears in SCOPe 2.05
- d1yq3b1 appears in SCOPe 2.07
- d1yq3b1 appears in the current release, SCOPe 2.08
View in 3D
