Lineage for d1ypqb_ (1ypq B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1682071Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1682072Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1682776Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 1682777Protein automated matches [190159] (12 species)
    not a true protein
  7. 1682825Species Human (Homo sapiens) [TaxId:9606] [186882] (61 PDB entries)
  8. 1682828Domain d1ypqb_: 1ypq B: [123834]
    Other proteins in same PDB: d1ypqa1
    automated match to d1hyra_
    complexed with dio

Details for d1ypqb_

PDB Entry: 1ypq (more details), 1.4 Å

PDB Description: Human Oxidized Low Density Lipoprotein Receptor LOX-1 Dioxane Complex
PDB Compounds: (B:) oxidised low density lipoprotein (lectin-like) receptor 1

SCOPe Domain Sequences for d1ypqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ypqb_ d.169.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rvancsapcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqai
syssfpfwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaen
cilaafsicqkkanl

SCOPe Domain Coordinates for d1ypqb_:

Click to download the PDB-style file with coordinates for d1ypqb_.
(The format of our PDB-style files is described here.)

Timeline for d1ypqb_: