Lineage for d1yioa1 (1yio A:131-200)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695233Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 2695270Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (5 proteins)
    contains additional, fourth helix in the C-terminal extension
  6. 2695306Protein Response regulatory protein StyR, C-terminal domain [140317] (1 species)
  7. 2695307Species Pseudomonas fluorescens [TaxId:294] [140318] (2 PDB entries)
    Uniprot O30989 131-200
  8. 2695308Domain d1yioa1: 1yio A:131-200 [123326]
    Other proteins in same PDB: d1yioa2
    complexed with hg, mg

Details for d1yioa1

PDB Entry: 1yio (more details), 2.2 Å

PDB Description: Crystallographic structure of response regulator StyR from Pseudomonas fluorescens
PDB Compounds: (A:) response regulatory protein

SCOPe Domain Sequences for d1yioa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yioa1 a.4.6.2 (A:131-200) Response regulatory protein StyR, C-terminal domain {Pseudomonas fluorescens [TaxId: 294]}
etqdqleqlfssltgreqqvlqltirglmnkqiagelgiaevtvkvhrhnimqklnvrsl
anlvhlveky

SCOPe Domain Coordinates for d1yioa1:

Click to download the PDB-style file with coordinates for d1yioa1.
(The format of our PDB-style files is described here.)

Timeline for d1yioa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yioa2