Lineage for d1yh2a1 (1yh2 A:1-154)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.20: UBC-like [54494] (1 superfamily)
alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2Superfamily d.20.1: UBC-like [54495] (5 families) 
Family d.20.1.1: UBC-related [54496] (7 proteins) Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species) 
Species Human (Homo sapiens), E2 T [TaxId:9606] [143057] (1 PDB entry)
Uniprot Q9NPD8 1-154
Hspc150
Domain d1yh2a1: 1yh2 A:1-154 [123158]
Other proteins in same PDB: d1yh2a2
Details for d1yh2a1
PDB Entry: 1yh2 (more details), 2 Å
PDB Description: Ubiquitin-Conjugating Enzyme HSPC150
PDB Compounds: (A:) HSPC150 protein similar to ubiquitin-conjugating enzymeSCOPe Domain Sequences for d1yh2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]}
mqrasrlkrelhmlatepppgitcwqdkdqmddlraqilggantpyekgvfkleviiper
ypfeppqirfltpiyhpnidsagricldvlklppkgawrpslniatvltsiqllmsepnp
ddplmadissefkynkpaflknarqwtekharqk
SCOPe Domain Coordinates for d1yh2a1:
Click to download the PDB-style file with coordinates for d1yh2a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1yh2a1:
- d1yh2a1 first appeared in SCOP 1.73
- d1yh2a1 appears in SCOPe 2.07
View in 3D
