Lineage for d1ygha_ (1ygh A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
3 layers: a/b/a; contains mixed beta-sheetSuperfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) 
Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) 
Protein Catalytic domain of GCN5 histone acetyltransferase [55737] (3 species) 
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55738] (1 PDB entry) 
Domain d1ygha_: 1ygh A: [40802]
complexed with gol
Details for d1ygha_
PDB Entry: 1ygh (more details), 1.9 Å
PDB Description: hat domain of gcn5 from saccharomyces cerevisiae
PDB Compounds: (A:) protein (transcriptional activator gcn5)SCOPe Domain Sequences for d1ygha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kiefrvvnndntkenmmvltglknifqkqlpkmpkeyiarlvydrshlsmavirkpltvv
ggityrpfdkrefaeivfcaissteqvrgygahlmnhlkdyvrntsnikyfltyadnyai
gyfkkqgftkeitldksiwmgyikdyeggtlmqcsmlpriryld
SCOPe Domain Coordinates for d1ygha_:
Click to download the PDB-style file with coordinates for d1ygha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ygha_:
- d1ygha_ first appeared (with stable ids) in SCOP 1.55
- d1ygha_ appears in SCOPe 2.07
View in 3D
