Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) |
Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
Protein Catalytic domain of GCN5 histone acetyltransferase [55737] (3 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55738] (1 PDB entry) |
Domain d1ygha_: 1ygh A: [40802] complexed with gol |
PDB Entry: 1ygh (more details), 1.9 Å
SCOPe Domain Sequences for d1ygha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kiefrvvnndntkenmmvltglknifqkqlpkmpkeyiarlvydrshlsmavirkpltvv ggityrpfdkrefaeivfcaissteqvrgygahlmnhlkdyvrntsnikyfltyadnyai gyfkkqgftkeitldksiwmgyikdyeggtlmqcsmlpriryld
Timeline for d1ygha_: