Lineage for d1yg9a_ (1yg9 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1796116Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1796117Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1798303Family b.50.1.0: automated matches [191552] (1 protein)
    not a true family
  6. 1798304Protein automated matches [190954] (9 species)
    not a true protein
  7. 1798305Species Blattella germanica [TaxId:6973] [189570] (4 PDB entries)
  8. 1798306Domain d1yg9a_: 1yg9 A: [193847]
    automated match to d3liza_
    complexed with nag, zn; mutant

Details for d1yg9a_

PDB Entry: 1yg9 (more details), 1.3 Å

PDB Description: the structure of mutant (n93q) of bla g 2
PDB Compounds: (A:) Aspartic protease Bla g 2

SCOPe Domain Sequences for d1yg9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yg9a_ b.50.1.0 (A:) automated matches {Blattella germanica [TaxId: 6973]}
gasivplyklvhvfintqyagitkignqnfltvfdstscnvvvasqecvggacvcpnlqk
yeklkpkyisdgnvqvkffdtgsavgrgiedsltisqlttsqqdivladelsqevcilsa
dvvvgiaapgcpnalkgktvlenfveenliapvfsihharfqdgehfgeiifggsdwkyv
dgeftyvplvgddswkfrldgvkigdttvapagtqaiidtskaiivgpkayvnpineaig
cvvektttrrickldcskipslpdvtfvingrnfnissqyyiqqngnlcysgfqpcghsd
hffigdffvdhyysefnwenktmgfgrsve

SCOPe Domain Coordinates for d1yg9a_:

Click to download the PDB-style file with coordinates for d1yg9a_.
(The format of our PDB-style files is described here.)

Timeline for d1yg9a_: