Class b: All beta proteins [48724] (176 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.0: automated matches [191552] (1 protein) not a true family |
Protein automated matches [190954] (9 species) not a true protein |
Species Blattella germanica [TaxId:6973] [189570] (4 PDB entries) |
Domain d1yg9a_: 1yg9 A: [193847] automated match to d3liza_ complexed with nag, zn; mutant |
PDB Entry: 1yg9 (more details), 1.3 Å
SCOPe Domain Sequences for d1yg9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yg9a_ b.50.1.0 (A:) automated matches {Blattella germanica [TaxId: 6973]} gasivplyklvhvfintqyagitkignqnfltvfdstscnvvvasqecvggacvcpnlqk yeklkpkyisdgnvqvkffdtgsavgrgiedsltisqlttsqqdivladelsqevcilsa dvvvgiaapgcpnalkgktvlenfveenliapvfsihharfqdgehfgeiifggsdwkyv dgeftyvplvgddswkfrldgvkigdttvapagtqaiidtskaiivgpkayvnpineaig cvvektttrrickldcskipslpdvtfvingrnfnissqyyiqqngnlcysgfqpcghsd hffigdffvdhyysefnwenktmgfgrsve
Timeline for d1yg9a_: