Lineage for d1ycra_ (1ycr A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 769486Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 769487Superfamily a.42.1: SWIB/MDM2 domain [47592] (1 family) (S)
    binds to the transactivation domain of human p53
  5. 769488Family a.42.1.1: SWIB/MDM2 domain [47593] (4 proteins)
    Pfam PF02201
  6. 769495Protein MDM2 [47594] (2 species)
  7. 769499Species Human (Homo sapiens) [TaxId:9606] [47596] (6 PDB entries)
  8. 769506Domain d1ycra_: 1ycr A: [17420]

Details for d1ycra_

PDB Entry: 1ycr (more details), 2.6 Å

PDB Description: mdm2 bound to the transactivation domain of p53
PDB Compounds: (A:) mdm2

SCOP Domain Sequences for d1ycra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ycra_ a.42.1.1 (A:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
etlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
lfgvpsfsvkehrkiytmiyrnlvv

SCOP Domain Coordinates for d1ycra_:

Click to download the PDB-style file with coordinates for d1ycra_.
(The format of our PDB-style files is described here.)

Timeline for d1ycra_: