Lineage for d1ycqa_ (1ycq A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1270168Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 1270169Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 1270170Family a.42.1.1: SWIB/MDM2 domain [47593] (4 proteins)
    Pfam PF02201
  6. 1270177Protein MDM2 [47594] (2 species)
  7. 1270178Species African clawed frog (Xenopus laevis) [TaxId:8355] [47595] (9 PDB entries)
    Uniprot P56273 13-119
  8. 1270186Domain d1ycqa_: 1ycq A: [17419]
    protein/DNA complex

Details for d1ycqa_

PDB Entry: 1ycq (more details), 2.3 Å

PDB Description: xenopus laevis mdm2 bound to the transactivation domain of human p53
PDB Compounds: (A:) mdm2

SCOPe Domain Sequences for d1ycqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ycqa_ a.42.1.1 (A:) MDM2 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
eklvqptplllsllksagaqketftmkeviyhlgqyimakqlydekqqhivhcsndplge
lfgvqefsvkeprrlyamisrnlvsanv

SCOPe Domain Coordinates for d1ycqa_:

Click to download the PDB-style file with coordinates for d1ycqa_.
(The format of our PDB-style files is described here.)

Timeline for d1ycqa_: