SCOPe 2.08: Domain d1ycga2: 1ycg A:2-250

Lineage for d1ycga2 (1ycg A:2-250)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families)
Family d.157.1.3: ROO N-terminal domain-like [56291] (4 proteins)
Protein Nitric oxide reductase N-terminal domain [143914] (2 species)
Species Moorella thermoacetica [TaxId:1525] [143915] (3 PDB entries)
Uniprot Q9FDN7 2-250
Domain d1ycga2: 1ycg A:2-250 [122950]
Other proteins in same PDB: d1ycga1, d1ycgb1, d1ycgc1, d1ycgd1
automated match to d1ycfa2
complexed with edo, feo, fmn, zn

Details for d1ycga2

PDB Entry: 1ycg (more details), 2.8 Å

PDB Description: x-ray structures of moorella thermoacetica fpra. novel diiron site structure and mechanistic insights into a scavenging nitric oxide reductase

PDB Compounds: (A:) Nitric oxide reductase

SCOPe Domain Sequences for d1ycga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ycga2 d.157.1.3 (A:2-250) Nitric oxide reductase N-terminal domain {Moorella thermoacetica [TaxId: 1525]}
sqpvaitdgiywvgavdwniryfhgpafsthrgttynaylivddktalvdtvyepfkeel
iaklkqikdpvkldylvvnhtesdhagafpaimelcpdahvlctqrafdslkahyshidf
nytivktgtsvslgkrsltfieapmlhwpdsmftyvpeealllpndafgqhiatsvrfdd
qvdaglimdeaakyyanilmpfsnlitkkldeiqkinlaiktiapshgiiwrkdpgriie
ayarwaegq

SCOPe Domain Coordinates for d1ycga2:

Click to download the PDB-style file with coordinates for d1ycga2.
(The format of our PDB-style files is described here.)

Timeline for d1ycga2: