Lineage for d1ycfa2 (1ycf A:2-250)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2997099Family d.157.1.3: ROO N-terminal domain-like [56291] (4 proteins)
  6. 2997100Protein Nitric oxide reductase N-terminal domain [143914] (2 species)
  7. 2997104Species Moorella thermoacetica [TaxId:1525] [143915] (3 PDB entries)
    Uniprot Q9FDN7 2-250
  8. 2997113Domain d1ycfa2: 1ycf A:2-250 [122942]
    Other proteins in same PDB: d1ycfa1, d1ycfb1, d1ycfb2, d1ycfc1, d1ycfc2, d1ycfd1, d1ycfd2
    complexed with feo, fmn, oxy, zn

Details for d1ycfa2

PDB Entry: 1ycf (more details), 3 Å

PDB Description: oxidized (di-ferric) fpra from moorella thermoacetica
PDB Compounds: (A:) Nitric oxide reductase

SCOPe Domain Sequences for d1ycfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ycfa2 d.157.1.3 (A:2-250) Nitric oxide reductase N-terminal domain {Moorella thermoacetica [TaxId: 1525]}
sqpvaitdgiywvgavdwniryfhgpafsthrgttynaylivddktalvdtvyepfkeel
iaklkqikdpvkldylvvnhtesdhagafpaimelcpdahvlctqrafdslkahyshidf
nytivktgtsvslgkrsltfieapmlhwpdsmftyvpeealllpndafgqhiatsvrfdd
qvdaglimdeaakyyanilmpfsnlitkkldeiqkinlaiktiapshgiiwrkdpgriie
ayarwaegq

SCOPe Domain Coordinates for d1ycfa2:

Click to download the PDB-style file with coordinates for d1ycfa2.
(The format of our PDB-style files is described here.)

Timeline for d1ycfa2: