Lineage for d1yc7b_ (1yc7 B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757949Protein automated matches [190119] (18 species)
    not a true protein
  7. 1757950Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (25 PDB entries)
  8. 1757958Domain d1yc7b_: 1yc7 B: [162179]
    automated match to d1op9a_
    complexed with so4

Details for d1yc7b_

PDB Entry: 1yc7 (more details), 1.6 Å

PDB Description: cAbAn33 VHH fragment against VSG
PDB Compounds: (B:) anti-VSG immunoglobulin heavy chain variable domain cAbAn33

SCOPe Domain Sequences for d1yc7b_:

Sequence, based on SEQRES records: (download)

>d1yc7b_ b.1.1.1 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
vqlvesgggsvqaggslrlscavsgstyspcttgwyrqapgkerewvssisspgtiyyqd
svkgrftisrdnakntvylqmnslqredtgmyycqiqcgvrsireywgqgtqvtvss

Sequence, based on observed residues (ATOM records): (download)

>d1yc7b_ b.1.1.1 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
vqlvesgggsvqaggslrlscavsgtyspcttgwyrqapgkerewvssisspgtiyyqds
vkgrftisrdnakntvylqmnslqredtgmyycqiqcgvrsireywgqgtqvtvss

SCOPe Domain Coordinates for d1yc7b_:

Click to download the PDB-style file with coordinates for d1yc7b_.
(The format of our PDB-style files is described here.)

Timeline for d1yc7b_: