Class a: All alpha proteins [46456] (284 folds) |
Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily) multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer |
Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (4 families) basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat |
Family a.204.1.4: HisE-like (PRA-PH) [140797] (1 protein) Pfam PF01503 |
Protein Phosphoribosyl-ATP pyrophosphatase HisE [140798] (5 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [140801] (1 PDB entry) Uniprot O33257 7-93 |
Domain d1y6xa1: 1y6x A:7-93 [122676] |
PDB Entry: 1y6x (more details), 1.25 Å
SCOP Domain Sequences for d1y6xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y6xa1 a.204.1.4 (A:7-93) Phosphoribosyl-ATP pyrophosphatase HisE {Mycobacterium tuberculosis [TaxId: 1773]} vktfedlfaelgdrartrpadsttvaaldggvhalgkklleeagevwlaaehesndalae eisqllywtqvlmisrglslddvyrkl
Timeline for d1y6xa1: