Lineage for d1y4ia1 (1y4i A:2-398)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1613158Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1613159Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1613596Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 1613721Protein Methionine gamma-lyase, MGL [64126] (4 species)
  7. 1613722Species Citrobacter freundii [TaxId:546] [142663] (9 PDB entries)
    Uniprot Q84AR1 2-398
  8. 1613729Domain d1y4ia1: 1y4i A:2-398 [122619]
    complexed with so4

Details for d1y4ia1

PDB Entry: 1y4i (more details), 1.9 Å

PDB Description: crystal structure of citrobacter freundii l-methionine-lyase
PDB Compounds: (A:) methionine gamma-lyase

SCOPe Domain Sequences for d1y4ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]}
sdcrtygfntqivhagqqpdpstgalstpifqtstfvfdsaeqgaarfaleesgyiytrl
gnpttdalekklavlergeaglatasgisaitttlltlcqqgdhivsasaiygcthafls
hsmpkfginvrfvdagkpeeiraamrpetkvvyietpanptlslvdietvagiahqqgal
lvvdntfmspycqqplqlgadivvhsvtkyinghgdviggiivgkqefidqarfvglkdi
tggcmspfnawltlrgvktlgirmerhcenalkiarfleghpsitrvyypglsshpqyel
gqrqmslpggiisfeiaggleagrrminsvelcllavslgdtetliqhpasmthspvape
erlkagitdglirlsvgledpediindlehairkatf

SCOPe Domain Coordinates for d1y4ia1:

Click to download the PDB-style file with coordinates for d1y4ia1.
(The format of our PDB-style files is described here.)

Timeline for d1y4ia1: