Lineage for d1xyza_ (1xyz A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1818795Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1819280Protein Xylanase [51488] (6 species)
  7. 1819310Species Clostridium thermocellum, XynZ [TaxId:1515] [51489] (1 PDB entry)
    belongs to family F
  8. 1819311Domain d1xyza_: 1xyz A: [28804]

Details for d1xyza_

PDB Entry: 1xyz (more details), 1.4 Å

PDB Description: a common protein fold and similar active site in two distinct families of beta-glycanases
PDB Compounds: (A:) 1,4-beta-d-xylan-xylanohydrolase

SCOPe Domain Sequences for d1xyza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xyza_ c.1.8.3 (A:) Xylanase {Clostridium thermocellum, XynZ [TaxId: 1515]}
nalrdyaeargikigtcvnypfynnsdptynsilqrefsmvvcenemkfdalqprqnvfd
fskgdqllafaerngmqmrghtliwhnqnpswltngnwnrdsllavmknhittvmthykg
kivewdvanecmddsgnglrssiwrnvigqdyldyafryareadpdallfyndyniedlg
pksnavfnmiksmkergvpidgvgfqchfingmspeylasidqnikryaeigvivsftei
diripqsenpatafqvqannykelmkiclanpncntfvmwgftdkytwipgtfpgygnpl
iydsnynpkpaynaikealm

SCOPe Domain Coordinates for d1xyza_:

Click to download the PDB-style file with coordinates for d1xyza_.
(The format of our PDB-style files is described here.)

Timeline for d1xyza_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xyzb_