Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein Xylanase [51488] (6 species) |
Species Clostridium thermocellum, XynZ [TaxId:1515] [51489] (1 PDB entry) belongs to family F |
Domain d1xyza_: 1xyz A: [28804] |
PDB Entry: 1xyz (more details), 1.4 Å
SCOPe Domain Sequences for d1xyza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xyza_ c.1.8.3 (A:) Xylanase {Clostridium thermocellum, XynZ [TaxId: 1515]} nalrdyaeargikigtcvnypfynnsdptynsilqrefsmvvcenemkfdalqprqnvfd fskgdqllafaerngmqmrghtliwhnqnpswltngnwnrdsllavmknhittvmthykg kivewdvanecmddsgnglrssiwrnvigqdyldyafryareadpdallfyndyniedlg pksnavfnmiksmkergvpidgvgfqchfingmspeylasidqnikryaeigvivsftei diripqsenpatafqvqannykelmkiclanpncntfvmwgftdkytwipgtfpgygnpl iydsnynpkpaynaikealm
Timeline for d1xyza_: