Class a: All alpha proteins [46456] (290 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) |
Family a.35.1.9: Bacteriophage CII protein [140520] (1 protein) Pfam PF05269; a compact helix-swapped dimer of the canonical fold; includes the extra C-terminal teramerisation region (alpha-helix); in the tetramer-DNA complex only two of the four HTH motifs interact with DNA |
Protein Regulatory protein cII [140521] (1 species) |
Species Bacteriophage lambda [TaxId:10710] [140522] (3 PDB entries) Uniprot P03042 2-80! Uniprot P03042 4-81 |
Domain d1xwra1: 1xwr A:2-80 [122406] complexed with ipa |
PDB Entry: 1xwr (more details), 2.56 Å
SCOPe Domain Sequences for d1xwra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xwra1 a.35.1.9 (A:2-80) Regulatory protein cII {Bacteriophage lambda [TaxId: 10710]} vrankrnealriesallnkiamlgtektaeavgvdksqisrwkrdwipkfsmllavlewg vvdddmarlarqvaailtn
Timeline for d1xwra1: