Lineage for d1xwra1 (1xwr A:2-80)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709704Family a.35.1.9: Bacteriophage CII protein [140520] (1 protein)
    Pfam PF05269; a compact helix-swapped dimer of the canonical fold; includes the extra C-terminal teramerisation region (alpha-helix); in the tetramer-DNA complex only two of the four HTH motifs interact with DNA
  6. 2709705Protein Regulatory protein cII [140521] (1 species)
  7. 2709706Species Bacteriophage lambda [TaxId:10710] [140522] (3 PDB entries)
    Uniprot P03042 2-80! Uniprot P03042 4-81
  8. 2709711Domain d1xwra1: 1xwr A:2-80 [122406]
    complexed with ipa

Details for d1xwra1

PDB Entry: 1xwr (more details), 2.56 Å

PDB Description: Crystal structure of the coliphage lambda transcription activator protein CII
PDB Compounds: (A:) Regulatory protein CII

SCOPe Domain Sequences for d1xwra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwra1 a.35.1.9 (A:2-80) Regulatory protein cII {Bacteriophage lambda [TaxId: 10710]}
vrankrnealriesallnkiamlgtektaeavgvdksqisrwkrdwipkfsmllavlewg
vvdddmarlarqvaailtn

SCOPe Domain Coordinates for d1xwra1:

Click to download the PDB-style file with coordinates for d1xwra1.
(The format of our PDB-style files is described here.)

Timeline for d1xwra1: