Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) less regular structure consisting of variable repeats |
Family c.10.2.7: Ngr ectodomain-like [75142] (7 proteins) applies to all domains of a family if the common domain is composed of a different number of small repeating units this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain |
Protein Follicle-stimulating hormone receptor [159450] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [159451] (1 PDB entry) Uniprot P23945 18-259 |
Domain d1xwdc1: 1xwd C:18-259 [144581] Other proteins in same PDB: d1xwda_, d1xwdb1, d1xwdd_, d1xwde_ complexed with nag, so4 |
PDB Entry: 1xwd (more details), 2.92 Å
SCOPe Domain Sequences for d1xwdc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} chhrichcsnrvflcqeskvteipsdlprnaielrfvltklrviqkgafsgfgdlekiei sqndvlevieadvfsnlpklheiriekannllyinpeafqnlpnlqyllisntgikhlpd vhkihslqkvlldiqdninihtiernsfvglsfesvilwlnkngiqeihncafngtqlde lnlsdnnnleelpndvfhgasgpvildisrtrihslpsyglenlkklrarstynlkklpt le
Timeline for d1xwdc1: