Lineage for d1xwaa_ (1xwa A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1852418Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 1852482Protein Thioredoxin [52835] (15 species)
  7. 1852585Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [117589] (4 PDB entries)
    Uniprot Q9V429
  8. 1852586Domain d1xwaa_: 1xwa A: [116116]
    complexed with cd, cl

Details for d1xwaa_

PDB Entry: 1xwa (more details), 2.2 Å

PDB Description: Drospohila thioredoxin, oxidized, P41212
PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d1xwaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
aaaaamvyqvkdkadldgqltkasgklvvldffatwcgpckmispklvelstqfadnvvv
lkvdvdecediameynissmptfvflkngvkveefaganakrledvikani

SCOPe Domain Coordinates for d1xwaa_:

Click to download the PDB-style file with coordinates for d1xwaa_.
(The format of our PDB-style files is described here.)

Timeline for d1xwaa_: