Lineage for d1xtqa1 (1xtq A:3-169)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1163638Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1164010Protein GTP-binding protein RheB [142275] (1 species)
  7. 1164011Species Human (Homo sapiens) [TaxId:9606] [142276] (2 PDB entries)
    Uniprot Q15382 3-169
  8. 1164014Domain d1xtqa1: 1xtq A:3-169 [122297]
    complexed with gdp, mg

Details for d1xtqa1

PDB Entry: 1xtq (more details), 2 Å

PDB Description: structure of small gtpase human rheb in complex with gdp
PDB Compounds: (A:) GTP-binding protein Rheb

SCOPe Domain Sequences for d1xtqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]}
qsksrkiailgyrsvgkssltiqfvegqfvdsydptientftklitvngqeyhlqlvdta
gqdeysifpqtysidingyilvysvtsiksfevikvihgklldmvgkvqipimlvgnkkd
lhmervisyeegkalaeswnaaflessakenqtavdvfrriileaek

SCOPe Domain Coordinates for d1xtqa1:

Click to download the PDB-style file with coordinates for d1xtqa1.
(The format of our PDB-style files is described here.)

Timeline for d1xtqa1: