SCOPe 2.03: Domain d1xpma2: 1xpm A:168-388

Lineage for d1xpma2 (1xpm A:168-388)

Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

Fold c.95: Thiolase-like [53900] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

Superfamily c.95.1: Thiolase-like [53901] (3 families)
Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)
Protein 3-hydroxy-3-methylglutaryl CoA synthase MvaS [110760] (2 species)
most similar to FabH
Species Staphylococcus aureus [TaxId:1280] [110761] (5 PDB entries)
Uniprot Q7A3F6
Domain d1xpma2: 1xpm A:168-388 [115760]
complexed with caa, hmg, so4

Details for d1xpma2

PDB Entry: 1xpm (more details), 1.6 Å

PDB Description: crystal structure of staphylococcus aureus hmg-coa synthase with hmg- coa and acetoacetyl-coa and acetylated cysteine

PDB Compounds: (A:) 3-hydroxy-3-methylglutaryl CoA synthase

SCOPe Domain Sequences for d1xpma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xpma2 c.95.1.2 (A:168-388) 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Staphylococcus aureus [TaxId: 1280]}
ilalnedavaytedvydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladf
aslcfhvpftkmgkkalesiidnadettqerlrsgyedavdynryvgniytgslylslis
llenrdlqagetiglfsygsgsvgefysatlvegykdhldqaahkallnnrtevsvdaye
tffkrfddvefdeeqdavhedrhifylsniennvreyhrpe

SCOPe Domain Coordinates for d1xpma2:

Click to download the PDB-style file with coordinates for d1xpma2.
(The format of our PDB-style files is described here.)

Timeline for d1xpma2: