Lineage for d1xmaa_ (1xma A:)
- Root: SCOPe 2.02
Class a: All alpha proteins [46456] (284 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and downSuperfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) 
contains a small beta-sheet (wing)
Family a.4.5.61: PadR-like [116807] (3 proteins)
Pfam PF03551; related to the MarR-like family (Pfam PF01047)
Protein Predicted transcriptional regulator [116808] (1 species)
monomericSpecies Clostridium thermocellum [TaxId:1515] [116809] (1 PDB entry)
Uniprot Q4CEJ8 4-106
Domain d1xmaa_: 1xma A: [115477]
complexed with hg, unx
Details for d1xmaa_
PDB Entry: 1xma (more details), 2.3 Å
PDB Description: structure of a transcriptional regulator from clostridium thermocellum cth-833
PDB Compounds: (A:) Predicted transcriptional regulatorSCOPe Domain Sequences for d1xmaa_:
Sequence, based on SEQRES records: (download)
>d1xmaa_ a.4.5.61 (A:) Predicted transcriptional regulator {Clostridium thermocellum [TaxId: 1515]}
sdvirgyvdtiilslliegdsygyeiskniriktdelyvikettlysafarlekngyiks
yygeetqgkrrtyyritpegikyykqkceeweltkkvinkfvk
Sequence, based on observed residues (ATOM records): (download)
>d1xmaa_ a.4.5.61 (A:) Predicted transcriptional regulator {Clostridium thermocellum [TaxId: 1515]}
sdvirgyvdtiilslliegdsygyeiskniriktdelyvikettlysafarlekngyiks
yygeetkrrtyyritpegikyykqkceeweltkkvinkfvk
SCOPe Domain Coordinates for d1xmaa_:
Click to download the PDB-style file with coordinates for d1xmaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xmaa_:
- d1xmaa_ first appeared in SCOP 1.71
- d1xmaa_ appears in SCOPe 2.01
- d1xmaa_ appears in SCOPe 2.03
- d1xmaa_ appears in the current release, SCOPe 2.08
View in 3D
