| Class g: Small proteins [56992] (94 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
| Family g.3.11.1: EGF-type module [57197] (23 proteins) |
| Protein Factor X, N-terminal module [57205] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57206] (85 PDB entries) Uniprot P00742 127-178 |
| Domain d1xkal1: 1xka L:49-86 [44236] Other proteins in same PDB: d1xkac_ complexed with 4pp, ca |
PDB Entry: 1xka (more details), 2.3 Å
SCOPe Domain Sequences for d1xkal1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xkal1 g.3.11.1 (L:49-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]}
qcetspcqnqgkckdglgeytctclegfegkncelftr
Timeline for d1xkal1: