Lineage for d1xjca_ (1xjc A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1847600Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 1847798Protein Molybdopterin-guanine dinucleotide biosynthesis protein MobB [89673] (2 species)
    forms segment-swapped dimer
  7. 1847799Species Bacillus stearothermophilus [TaxId:1422] [117539] (1 PDB entry)
    Uniprot Q5L1X2 # 91% sequence identity
  8. 1847800Domain d1xjca_: 1xjc A: [115387]

Details for d1xjca_

PDB Entry: 1xjc (more details), 2.1 Å

PDB Description: X-ray crystal structure of MobB protein homolog from Bacillus stearothermophilus
PDB Compounds: (A:) MobB protein homolog

SCOPe Domain Sequences for d1xjca_:

Sequence, based on SEQRES records: (download)

>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]}
mnvwqvvgykhsgkttlmekwvaaavregwrvgtvkhhghggeparpegvdsvrheraga
vatavegdgllqlhlrrplwrlddvlalyaplrldlvlvegykqerhpkvvlvrseedwa
slqhlaniraviaweplegplahpvfsladddeyipwlmnevrtr

Sequence, based on observed residues (ATOM records): (download)

>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]}
mnvwqvvgykhsgkttlmekwvaaavregwrvgtvkhhgavatavegdgllqlhlrrplw
rlddvlalyaplrldlvlvegykqerhpkvvlvrseedwaslqhlaniraviaweplegp
lahpvfsladddeyipwlmnevrtr

SCOPe Domain Coordinates for d1xjca_:

Click to download the PDB-style file with coordinates for d1xjca_.
(The format of our PDB-style files is described here.)

Timeline for d1xjca_: