Lineage for d1x6va3 (1x6v A:34-228)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866412Family c.37.1.4: Adenosine-5'phosphosulfate kinase (APS kinase) [52572] (2 proteins)
    automatically mapped to Pfam PF01583
  6. 2866413Protein Adenosine-5'phosphosulfate kinase (APS kinase) [52573] (2 species)
  7. 2866425Species Human (Homo sapiens) [TaxId:9606] [142215] (3 PDB entries)
    Uniprot O43252 34-228
  8. 2866426Domain d1x6va3: 1x6v A:34-228 [121757]
    Other proteins in same PDB: d1x6va1, d1x6va2, d1x6va4, d1x6vb1, d1x6vb2
    complexed with adp, cl

Details for d1x6va3

PDB Entry: 1x6v (more details), 1.75 Å

PDB Description: the crystal structure of human 3'-phosphoadenosine-5'-phosphosulfate synthetase 1
PDB Compounds: (A:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1

SCOPe Domain Sequences for d1x6va3:

Sequence, based on SEQRES records: (download)

>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]}
hvsrnkrgqvvgtrggfrgctvwltglsgagkttvsmaleeylvchgipcytldgdnirq
glnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrnnarqihegaslpf
fevfvdaplhvceqrdvkglykkarageikgftgidseyekpeapelvlktdscdvndcv
qqvvellqerdivpv

Sequence, based on observed residues (ATOM records): (download)

>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]}
hvsrnkrgqvvgtrggfrgctvwltglsgagkttvsmaleeylvchgipcytldgdnirq
glnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrnnarqihegaslpf
fevfvdaeyekpeapelvlktdscdvndcvqqvvellqerdivpv

SCOPe Domain Coordinates for d1x6va3:

Click to download the PDB-style file with coordinates for d1x6va3.
(The format of our PDB-style files is described here.)

Timeline for d1x6va3: