Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein Splicing factor 3B subunit 4 [143318] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [143319] (2 PDB entries) Uniprot Q15427 102-184! Uniprot Q15427 4-96 |
Domain d1x5ua1: 1x5u A:7-99 [121721] 1st RBD |
PDB Entry: 1x5u (more details)
SCOPe Domain Sequences for d1x5ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} gpisernqdatvyvggldekvsepllwelflqagpvvnthmpkdrvtgqhqgygfvefls eedadyaikimdmiklygkpirvnkasahnknl
Timeline for d1x5ua1: