Lineage for d1x5ua1 (1x5u A:8-99)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195051Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 2195438Protein Splicing factor 3B subunit 4 [143318] (1 species)
  7. 2195439Species Human (Homo sapiens) [TaxId:9606] [143319] (2 PDB entries)
    Uniprot Q15427 102-184! Uniprot Q15427 4-96
  8. 2195441Domain d1x5ua1: 1x5u A:8-99 [121721]
    Other proteins in same PDB: d1x5ua2, d1x5ua3
    1st RBD

Details for d1x5ua1

PDB Entry: 1x5u (more details)

PDB Description: solution structure of rrm domain in splicing factor 3b
PDB Compounds: (A:) Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit).

SCOPe Domain Sequences for d1x5ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x5ua1 d.58.7.1 (A:8-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]}
pisernqdatvyvggldekvsepllwelflqagpvvnthmpkdrvtgqhqgygfveflse
edadyaikimdmiklygkpirvnkasahnknl

SCOPe Domain Coordinates for d1x5ua1:

Click to download the PDB-style file with coordinates for d1x5ua1.
(The format of our PDB-style files is described here.)

Timeline for d1x5ua1: