Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein Cold-inducible RNA-binding protein [143300] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [143301] (1 PDB entry) Uniprot Q14011 1-90 |
Domain d1x5sa1: 1x5s A:8-97 [121719] |
PDB Entry: 1x5s (more details)
SCOPe Domain Sequences for d1x5sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} masdegklfvgglsfdtneqsleqvfskygqisevvvvkdretqrsrgfgfvtfenidda kdammamngksvdgrqirvdqagkssdnrs
Timeline for d1x5sa1: