Class b: All beta proteins [48724] (180 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
Protein Scribble (KIAA0147) [101731] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101732] (9 PDB entries) Uniprot Q14160 680-951, 1096-1193 # structure of 1st PDZ domain is also known, 1XQ5 |
Domain d1x5qa1: 1x5q A:8-104 [121717] Other proteins in same PDB: d1x5qa2, d1x5qa3 1st PDZ domain |
PDB Entry: 1x5q (more details)
SCOPe Domain Sequences for d1x5qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} eparieeeeltltilrqtgglgisiaggkgstpykgddegifisrvseegpaaragvrvg dkllevngvalqgaehheavealrgagtavqmrvwre
Timeline for d1x5qa1: