Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
Protein automated matches [190590] (26 species) not a true protein |
Species Tokunagayusurika akamusi [TaxId:28383] [188112] (10 PDB entries) |
Domain d1x3ka_: 1x3k A: [193197] automated match to d2g3ha_ complexed with hem |
PDB Entry: 1x3k (more details), 1.64 Å
SCOPe Domain Sequences for d1x3ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x3ka_ a.1.1.0 (A:) automated matches {Tokunagayusurika akamusi [TaxId: 28383]} afvglsdseeklvrdawapihgdlqgtantvfynylkkypsnqdkfetlkghpldevkdt anfkliagriftifdncvknvgndkgfqkviadmsgphvarpithgsyndlrgviydsmh ldsthgaawnkmmdnffyvfyecldgrcsqfs
Timeline for d1x3ka_: