Lineage for d1x0jb_ (1x0j B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. Protein automated matches [190615] (14 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1029 PDB entries)
  8. Domain d1x0jb_: 1x0j B: [162016]
    automated match to d1jm4b_
    complexed with dtt, mes

Details for d1x0jb_

PDB Entry: 1x0j (more details), 1.8 Å

PDB Description: Crystal structure analysis of the N-terminal bromodomain of human Brd2
PDB Compounds: (B:) Bromodomain-containing protein 2

SCOPe Domain Sequences for d1x0jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x0jb_ a.29.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grvtnqlqylhkvvmkalwkhqfawpfrqpvdavklglpdyhkiikqpmdmgtikrrlen
nyywaasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmpqee

SCOPe Domain Coordinates for d1x0jb_ are not available.

Timeline for d1x0jb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1x0ja_, d1x0jc_