Lineage for d1wt9b_ (1wt9 B:)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.169: C-type lectin-like [56435] (1 superfamily)
unusual foldSuperfamily d.169.1: C-type lectin-like [56436] (9 families) 
Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
Pfam PF00059
Protein Snake coagglutinin beta chain [88867] (10 species)
heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
Species Sharp-nosed viper (Deinagkistrodon acutus) [TaxId:36307] [88871] (3 PDB entries) 
Domain d1wt9b_: 1wt9 B: [121255]
Other proteins in same PDB: d1wt9a1
automated match to d1iodb_
complexed with ca
Details for d1wt9b_
PDB Entry: 1wt9 (more details), 2.01 Å
PDB Description: crystal structure of Aa-X-bp-I, a snake venom protein with the activity of binding to coagulation factor X from Agkistrodon acutus
PDB Compounds: (B:) anticoagulant protein-BSCOPe Domain Sequences for d1wt9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wt9b_ d.169.1.1 (B:) Snake coagglutinin beta chain {Sharp-nosed viper (Deinagkistrodon acutus) [TaxId: 36307]}
dcpsdwssyeghcykpfnepknwadaenfctqqhtgshlvsfqsteeadfvvklafqtfd
ygifwmglskiwnqcnwqwsnaamlkytdwaeesycvyfkstnnkwrsitcrmianfvce
fqa
SCOPe Domain Coordinates for d1wt9b_:
Click to download the PDB-style file with coordinates for d1wt9b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wt9b_:
- d1wt9b_ first appeared in SCOP 1.73, called d1wt9b1
- d1wt9b_ appears in SCOPe 2.03
- d1wt9b_ appears in SCOPe 2.05
- d1wt9b_ appears in the current release, SCOPe 2.08
View in 3D
