![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.8: DIX domain [159926] (2 proteins) Pfam PF00778 |
![]() | Protein Axin 1 [159927] (1 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [159928] (2 PDB entries) Uniprot O70239 745-827 |
![]() | Domain d1wspa1: 1wsp A:750-832 [145834] complexed with bez, hg |
PDB Entry: 1wsp (more details), 2.9 Å
SCOPe Domain Sequences for d1wspa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wspa1 d.15.1.8 (A:750-832) Axin 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]} cdsivvayyfcgepipyrtlvrgravtlgqfkelltkkgsyryyfkkvsdefdcgvvfee vredeailpvfeekiigkvekvd
Timeline for d1wspa1: