Lineage for d1wrbb_ (1wrb B:)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins)
duplication: tandem repeat of two RecA-like (AAA) domains
Protein automated matches [190301] (3 species)
not a true protein
Species Flatworm (Dugesia japonica) [TaxId:6161] [188089] (1 PDB entry) 
Domain d1wrbb_: 1wrb B: [121193]
Other proteins in same PDB: d1wrba1
automated match to d1wrba1
complexed with so4
Details for d1wrbb_
PDB Entry: 1wrb (more details), 2.4 Å
PDB Description: Crystal structure of the N-terminal RecA-like domain of DjVLGB, a pranarian Vasa-like RNA helicase
PDB Compounds: (B:) DjVLGBSCOPe Domain Sequences for d1wrbb_:
Sequence, based on SEQRES records: (download)
>d1wrbb_ c.37.1.19 (B:) automated matches {Flatworm (Dugesia japonica) [TaxId: 6161]}
sipvsvtgpdysatnvienfdelkldptirnnillasyqrptpiqknaipailehrdima
caqtgsgktaaflipiinhlvcqdlnqqrysktaypkclilaptrelaiqilsesqkfsl
ntplrscvvyggadthsqirevqmgchllvatpgrlvdfieknkislefckyivldeadr
mldmgfepqirkiieesnmpsginrqtlmfsatfpkeiqklaadflynyifmtvgr
Sequence, based on observed residues (ATOM records): (download)
>d1wrbb_ c.37.1.19 (B:) automated matches {Flatworm (Dugesia japonica) [TaxId: 6161]}
sipvsvtgpdysatnvienfdelkldptirnnillasyqrptpiqknaipailehrdima
caqtgsgktaaflipiinhlvcqdlysktaypkclilaptrelaiqilsesqkfslntpl
rscvvyggadthsqirevqmgchllvatpgrlvdfieknkislefckyivldeadrmldm
gfepqirkiieesnmpsginrqtlmfsatfpkeiqklaadflynyifmtvgr
SCOPe Domain Coordinates for d1wrbb_:
Click to download the PDB-style file with coordinates for d1wrbb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wrbb_:
- d1wrbb_ first appeared in SCOP 1.73, called d1wrbb1
- d1wrbb_ appears in SCOPe 2.02
- d1wrbb_ appears in SCOPe 2.04
- d1wrbb_ appears in the current release, SCOPe 2.08
View in 3D
