Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins) Pfam PF00866 |
Protein Small subunit of cumene dioxygenase CumA2 [142997] (1 species) |
Species Pseudomonas fluorescens [TaxId:294] [142998] (1 PDB entry) Uniprot Q51744 6-186 |
Domain d1wqlb1: 1wql B:5-186 [121172] Other proteins in same PDB: d1wqla1, d1wqla2 complexed with fe2, fes, oxy |
PDB Entry: 1wql (more details), 2.2 Å
SCOPe Domain Sequences for d1wqlb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wqlb1 d.17.4.4 (B:5-186) Small subunit of cumene dioxygenase CumA2 {Pseudomonas fluorescens [TaxId: 294]} dltkpiewpempvslelqnaveqfyyreaqlldyqnyeawlalltqdiqywmpirtthts rnkameyvppggnahfdetyesmrarirarvsglnwtedppsrsrhivsnvivretesag tlevssaflcyrnrlermtdiyvgerrdillrvsdglgfkiakrtilldqstitannlsq ff
Timeline for d1wqlb1: