Lineage for d1wqla1 (1wql A:19-180)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535669Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 1535670Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 1535773Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)
  6. 1535802Protein Large subunit of cumene dioxygenase cumA1 [141182] (1 species)
  7. 1535803Species Pseudomonas fluorescens [TaxId:294] [141183] (1 PDB entry)
    Uniprot Q51743 19-180
  8. 1535804Domain d1wqla1: 1wql A:19-180 [121170]
    Other proteins in same PDB: d1wqla2, d1wqlb1
    complexed with fe2, fes, oxy

Details for d1wqla1

PDB Entry: 1wql (more details), 2.2 Å

PDB Description: Cumene dioxygenase (cumA1A2) from Pseudomonas fluorescens IP01
PDB Compounds: (A:) iron-sulfur protein large subunit of cumene dioxygenase

SCOPe Domain Sequences for d1wqla1:

Sequence, based on SEQRES records: (download)

>d1wqla1 b.33.1.2 (A:19-180) Large subunit of cumene dioxygenase cumA1 {Pseudomonas fluorescens [TaxId: 294]}
nwsdeeikalvdeekglldprifsdqdlyeielervfarswlllgheghipkagdyltty
mgedpvivvrqkdrsikvflnqcrhrgmriersdfgnaksftctyhgwaydtagnlvnvp
yekeafcdkkegdcgfdkadwgplqarvdtykglifanwdte

Sequence, based on observed residues (ATOM records): (download)

>d1wqla1 b.33.1.2 (A:19-180) Large subunit of cumene dioxygenase cumA1 {Pseudomonas fluorescens [TaxId: 294]}
nwsdeeikalvdeekglldprifsdqdlyeielervfarswlllgheghipkagdyltty
mgedpvivvrqkdrsikvflnqcrhrgmriersdfgnaksftctyhgwaydtagnlvnvp
yekeafcdcgfdkadwgplqarvdtykglifanwdte

SCOPe Domain Coordinates for d1wqla1:

Click to download the PDB-style file with coordinates for d1wqla1.
(The format of our PDB-style files is described here.)

Timeline for d1wqla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wqla2
View in 3D
Domains from other chains:
(mouse over for more information)
d1wqlb1