Lineage for d1wpca1 (1wpc A:399-485)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
folded sheet; greek-keySuperfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) 
this domain is C-terminal to the catalytic beta/alpha barrel domainFamily b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
this domain follows the catalytic beta/alpha barrel domain
Protein Bacterial alpha-Amylase [51013] (9 species) 
Species Bacillus sp. 707 [TaxId:1416] [117297] (4 PDB entries)
Uniprot P19571 38-518
Domain d1wpca1: 1wpc A:399-485 [114799]
Other proteins in same PDB: d1wpca2
complexed with aci, ca, na
Details for d1wpca1
PDB Entry: 1wpc (more details), 1.9 Å
PDB Description: crystal structure of maltohexaose-producing amylase complexed with pseudo-maltononaose
PDB Compounds: (A:) Glucan 1,4-alpha-maltohexaosidaseSCOPe Domain Sequences for d1wpca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wpca1 b.71.1.1 (A:399-485) Bacterial alpha-Amylase {Bacillus sp. 707 [TaxId: 1416]}
gkqndyldhhniigwtregntahpnsglatimsdgaggskwmfvgrnkagqvwsditgnr
tgtvtinadgwgnfsvnggsvsiwvnk
SCOPe Domain Coordinates for d1wpca1:
Click to download the PDB-style file with coordinates for d1wpca1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wpca1:
- d1wpca1 first appeared in SCOP 1.71
- d1wpca1 appears in SCOPe 2.07
View in 3D
