Lineage for d1wmya_ (1wmy A:)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.169: C-type lectin-like [56435] (1 superfamily)
unusual foldSuperfamily d.169.1: C-type lectin-like [56436] (9 families) 
Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
Pfam PF00059
Protein Lectin CEL-I [111262] (1 species) Species Cucumaria echinata [TaxId:40245] [111263] (2 PDB entries)
Uniprot Q7M462
Domain d1wmya_: 1wmy A: [109420]
complexed with ca, mpd
Details for d1wmya_
PDB Entry: 1wmy (more details), 2 Å
PDB Description: Crystal Structure of C-type Lectin CEL-I from Cucumaria echinata
PDB Compounds: (A:) lectin CEL-I, N-acetyl-D-galactosamine-specific C-typeSCOPe Domain Sequences for d1wmya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wmya_ d.169.1.1 (A:) Lectin CEL-I {Cucumaria echinata [TaxId: 40245]}
nqcptdweaegdhcyrffntlttwenahhecvsyscstlnvrsdlvsvhsaaeqayvfny
wrgidsqagqlwiglydkynegdfiwtdgskvgytkwaggqpdnwnnaedygqfrhtegg
awndnsaaaqakymckltfe
SCOPe Domain Coordinates for d1wmya_:
Click to download the PDB-style file with coordinates for d1wmya_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wmya_:
- d1wmya_ first appeared in SCOP 1.69
- d1wmya_ appears in SCOPe 2.05
- d1wmya_ appears in SCOPe 2.07
- d1wmya_ appears in the current release, SCOPe 2.08
View in 3D
